KEGG   Pseudomonas sp. NS1(2017): CI807_01820
Entry
CI807_01820       CDS       T11105                                 
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
psns  Pseudomonas sp. NS1(2017)
Brite
KEGG Orthology (KO) [BR:psns00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psns03016]
    CI807_01820
Enzymes [BR:psns01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     CI807_01820
Transfer RNA biogenesis [BR:psns03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    CI807_01820
 Prokaryotic type
    CI807_01820
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2 PUA_3
Other DBs
NCBI-ProteinID: ASV34966
LinkDB
Position
complement(382249..383166)
AA seq 305 aa
MAQVKRIRRNVSGIILLDKPIGFTSNAALQKVRWLLNAEKAGHTGSLDPLATGVLPLCFG
EATKFSQYLLDSDKGYETLMQLGKTTTTADAEGDVLQVRDVTVGRADIEAALPGFRGQIS
QIPPMYSALKRDGQPLYKLARAGEVVEREPRSVTIARLELLACEGDTARLAVDCSKGTYI
RTLVEDIGEQLGCGAYVAELRRTQAGPFSLAQTVTLEELEAVHAEGGNEAVDRFLMPSDS
GLLNWPLLHFSEHSAFYWLNGQPVRAPDAPKFGMVRVQDHNGRFIGIGEVSEDGRIAPRR
LIRSE
NT seq 918 nt   +upstreamnt  +downstreamnt
gtggctcaggtcaaacgtatccgtcgtaacgtcagcggcatcattctgctcgataagccc
attggctttacctccaatgccgcgttgcagaaggttcgctggctgctcaacgccgaaaag
gccgggcacaccggcagcctcgatcccttggccaccggtgtactaccgttgtgcttcggc
gaggccaccaagttctcgcaatacctgctcgattccgacaaggggtacgaaaccctgatg
caattgggcaagaccaccaccacggccgacgccgaaggtgatgttctgcaggttcgcgac
gtgaccgttggtcgtgcagatatagaagcggctttacccggttttcgtgggcaaatcagt
cagataccgccgatgtactcggcgctcaagcgtgatggccagcctctttacaagctggca
cgtgcgggcgaagtagtggagcgtgaaccgcgttctgttactattgcgcgcttggaattg
ctcgcctgtgaaggcgacactgcccgcttggccgtggactgcagcaaaggcacctatatc
cgtaccttggtggaagatatcggtgaacagctcggttgcggtgcgtacgttgcagaactg
cgacgcacccaggccggccctttcagcctggcccagacggtcacgctggaagagttggag
gccgtacacgccgaaggcggcaacgaagcggttgatcgcttcctgatgccatcggacagc
ggtttgctgaattggccattgctgcacttttcggagcacagcgcgttctactggctcaac
ggccagccggtacgtgccccggatgctccgaagttcggcatggtgcgggtacaggatcat
aacggtcgcttcatcggtatcggtgaagtgagcgaagacgggcgcatcgcgccgcgtcga
ctgattcggtcagaatga

DBGET integrated database retrieval system