Pseudomonas sp. NS1(2017): CI807_08885 Help Entry CI807_08885       CDS       T11105                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psns  Pseudomonas sp. NS1(2017) Pathway psns01100   Metabolic pathways psns01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psns00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CI807_08885    00074 Mycolic acid biosynthesis     CI807_08885   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CI807_08885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ASV36288 LinkDB All DBs Position complement(1856084..1856353) Genome browser AA seq 89 aa AA seqDB search MSDQHRLEHDIKTLIIEALGLEDISVDDIGSEQTLFGEGLGLDSVDALELGLAIQKKYGI KIDADAKDTRNHFTNVASLAAFVTARQAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgaccaacaccgccttgagcacgacataaagacgctgatcatcgaggccctgggc ctggaagacatcagtgtcgacgacatcggcagcgagcagaccctgttcggcgaaggcctc ggcctggattcggtagacgccctggaattgggcctggcgatccagaaaaagtacggcatc aagatcgatgccgacgccaaggacacccgcaatcacttcaccaacgtggccagccttgcg gcgttcgtcacggccagacaggcagcttga

DBGET integrated database retrieval system