Pseudomonas sp. NS1(2017): CI807_13330 Help Entry CI807_13330       CDS       T11105                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism psns  Pseudomonas sp. NS1(2017) Brite KEGG Orthology (KO) [BR:psns00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psns03036]     CI807_13330 Chromosome and associated proteins [BR:psns03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     CI807_13330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ACCA_BT Motif Other DBs NCBI-ProteinID:  ASV37122 UniProt:  A0A223VP92 LinkDB All DBs Position 2826790..2827068 Genome browser AA seq 92 aa AA seqDB search MRSPNWLFLVLLLLLAGLQYRLWVGNGSFAQVKDLTEQIAAQHAENEILLERNRVLDAEV LELKKGTETVEERARHELGMVKEGETLYQLAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtcccaattggttgttcctcgtcttgctcttgttgctggctggcctgcagtac cgcctatgggtgggtaatggcagctttgcgcaggtaaaagacctgaccgagcaaattgct gcacagcacgccgaaaacgagatcctgctggagcgtaaccgcgtcctcgatgccgaagtg cttgagctgaaaaaaggtacggagaccgtggaagagcgggctcgtcatgaactgggcatg gtcaaggagggcgaaaccctctaccagttggcccaatga

DBGET integrated database retrieval system