Pseudomonas sp. NS1(2017): CI807_29730 Help Entry CI807_29730       CDS       T11105                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psns  Pseudomonas sp. NS1(2017) Pathway psns01100   Metabolic pathways psns01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psns00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CI807_29730    00074 Mycolic acid biosynthesis     CI807_29730   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CI807_29730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  ASV40211 LinkDB All DBs Position complement(6398482..6398718) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgtcgccgagcaactgggcgttaaagaa gaagaagtggtcaacactgcttccttcgtagaagacctgggtgccgattcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatcccggacgaagaagct gaaaaaatcactactgttcaagctgctatcgactacgttactagccaccaggcgtaa

DBGET integrated database retrieval system