Psychrobacter sp. G: PSYCG_05700 Help Entry PSYCG_05700       CDS       T02715                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism pso  Psychrobacter sp. G Pathway pso03430   Mismatch repair Brite KEGG Orthology (KO) [BR:pso00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     PSYCG_05700  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pso03400]     PSYCG_05700 Enzymes [BR:pso01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      PSYCG_05700 DNA repair and recombination proteins [BR:pso03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      PSYCG_05700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Apo-CII Phage_holin_7_1 Motif Other DBs NCBI-ProteinID:  AGP48665 LinkDB All DBs Position complement(1281240..1281485) Genome browser AA seq 81 aa AA seqDB search MSTPTRKRKKAAPKTFKAAYDILKTNAAELQQQDEPDIDNLMTTVEESIAAYRICETRIN AVQQALDAAFSEENKTVASES NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagcacccctactcgcaaacgcaaaaaagccgccccaaaaacttttaaggcggcctac gatatcttaaaaaccaatgctgctgaattgcagcaacaagatgagcctgatattgataat ctcatgaccactgttgaagaatcgattgccgcttatcgcatttgcgagactcgtattaac gcagtacaacaagctttagatgccgcattttctgaagaaaacaaaacggttgcaagcgag agctaa

DBGET integrated database retrieval system