Pseudomonas solani: PSm6_15450 Help Entry PSm6_15450        CDS       T09213                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psoa  Pseudomonas solani Pathway psoa01100   Metabolic pathways psoa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psoa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PSm6_15450    00074 Mycolic acid biosynthesis     PSm6_15450   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PSm6_15450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BCD85138 LinkDB All DBs Position 1664733..1664993 Genome browser AA seq 86 aa AA seqDB search MSALQLEIKNLIIEALGLEDIGPDDIDAEQTLFGEGLGLDSVDALELGLAIQKRFGIKID ADAKDTRKHFANVASLAAFVSAQKAA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgctctgcagcttgaaatcaagaacctgatcatcgaggccctgggcctcgaagac atcggccccgacgacatcgacgccgaacagaccctgttcggcgaaggcctgggcctggat tcggtggacgccctggaactgggcctggccatccagaagcgcttcggcatcaagatcgac gccgatgccaaggacacccgcaaacactttgccaacgtggccagcctcgcggccttcgtc tcggcacagaaagccgcttga

DBGET integrated database retrieval system