Pseudomonas solani: PSm6_15460 Help Entry PSm6_15460        CDS       T09213                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psoa  Pseudomonas solani Pathway psoa01100   Metabolic pathways psoa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psoa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PSm6_15460    00074 Mycolic acid biosynthesis     PSm6_15460   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PSm6_15460 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  BCD85139 LinkDB All DBs Position 1665006..1665260 Genome browser AA seq 84 aa AA seqDB search MQTRDEIFTTLRDALVELFELDPAQISLESNLYEDLEIDSIDAVDLIDHIKRHTGRKIAA EDFKAVRTVSDVVEAVHRLVNEPA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaacccgtgacgagatcttcaccaccctgcgcgacgccctggtcgaactcttcgag ctggacccggcgcagatcagcctggaatccaacctctacgaggacctggagatcgacagc atcgacgccgtggacctgatcgaccacatcaagcgccacaccggccgcaagatcgccgcc gaggacttcaaggccgtgcgcaccgtcagcgacgtggtcgaggccgtgcaccgcctggtg aacgagcccgcatga

DBGET integrated database retrieval system