Pseudomonas solani Sm006: PSm6_22830 Help Entry PSm6_22830        CDS       T09213                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism psoa  Pseudomonas solani Sm006 Brite KEGG Orthology (KO) [BR:psoa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psoa03036]     PSm6_22830 Chromosome and associated proteins [BR:psoa03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     PSm6_22830 SSDB OrthologParalogGFIT Motif Pfam:  ZapB SOGA1-2-like_CC Asd-4 Matrilin_ccoil ZapB_rel Filament USHBP1_PDZ-bd DUF7491 HAUS-augmin3 HAUS6_N Syntaxin Macoilin Neuromodulin_N DUF3450 MYCBP_helical DUF2205 Motif Other DBs NCBI-ProteinID:  BCD85876 UniProt:  A0AAU7Y481 LinkDB All DBs Position complement(2516443..2516652) Genome browser AA seq 69 aa AA seqDB search MEDAELQALTAKLELLIQRVEQLKSQNRQLQAAEKAWKEERAHLIEKNEMARQKVEAMIS RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacgcggaactgcaagccctcaccgccaagctggagctcctgatccagcgcgtt gagcagctcaagtcgcaaaaccggcaactgcaggcggctgaaaaagcctggaaagaagaa cgcgcccatctgatcgaaaagaacgaaatggcccggcagaaggtcgaagcgatgatttcg cgcctgaaagccctggagcaggattcatga

DBGET integrated database retrieval system