Pseudomonas solani: PSm6_39370 Help Entry PSm6_39370        CDS       T09213                                  Symbol acpP1 Name (GenBank) acyl carrier protein 1   KO K02078   acyl carrier protein Organism psoa  Pseudomonas solani Pathway psoa01100   Metabolic pathways psoa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psoa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PSm6_39370 (acpP1)    00074 Mycolic acid biosynthesis     PSm6_39370 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PSm6_39370 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  BCD87530 LinkDB All DBs Position 4299644..4299880 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEDEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYINAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgttaaagaa gacgaagtcaccaacagcgcttccttcgtcgaagacctgggcgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgagatcccggacgagcaagct gagaagatcaccaccgttcaggaagctatcgattacatcaacgcgcacgcgcaataa

DBGET integrated database retrieval system