Pseudomonas solani: PSm6_44860 Help Entry PSm6_44860        CDS       T09213                                  Symbol ppiC-2 Name (GenBank) peptidylprolyl isomerase   KO K03769   peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8] Organism psoa  Pseudomonas solani Brite KEGG Orthology (KO) [BR:psoa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:psoa03110]     PSm6_44860 (ppiC-2) Enzymes [BR:psoa01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      PSm6_44860 (ppiC-2) Chaperones and folding catalysts [BR:psoa03110]  Protein folding catalysts   Peptidyl prolyl isomerase    Parvulin     PSm6_44860 (ppiC-2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rotamase Rotamase_3 Rotamase_2 Mtf2_C Motif Other DBs NCBI-ProteinID:  BCD88079 LinkDB All DBs Position complement(4872941..4873219) Genome browser AA seq 92 aa AA seqDB search MAKALARHILVKTEAEAEQIKQRLAKGEDFAVLAKKHSLCPSGKRGGDLGEVRPGQMVRV IDQVIFKKPVRTIHGPVKSQFGYHLVQVFFRE NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atggccaaggcccttgcccgccacatcctggtcaagaccgaggcggaagccgaacagatc aagcagcgcctggccaagggcgaggacttcgccgtgctggcgaagaagcactcgctctgt ccctcgggcaagcgcggcggcgacctgggcgaagtgcgccccgggcagatggtgcgggtg atcgaccaggtgatcttcaaaaagccggtgcgcaccatccacggcccggtgaagagccag ttcggctaccacctggtgcaggtgttcttcagggagtga

DBGET integrated database retrieval system