Porphyromonas somerae: CE91St14_17520 Help Entry CE91St14_17520    CDS       T08199                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psoe  Porphyromonas somerae Pathway psoe01100   Metabolic pathways psoe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psoe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CE91St14_17520 (acpP)    00074 Mycolic acid biosynthesis     CE91St14_17520 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CE91St14_17520 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1493 Motif Other DBs NCBI-ProteinID:  BDE82724 LinkDB All DBs Position complement(2105169..2105417) Genome browser AA seq 82 aa AA seqDB search MTRQEIADKVIEIIVDKLNVDASEVTEAASFTNDLGADSLDTVELIMEFEKVFDINIEDE VSQNIQTVGDAISHIQAAIEQK NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacaagacaagaaattgcagacaaggtaatagagatcatcgtagataagcttaacgta gacgcgagcgaggtaactgaggcagctagcttcaccaatgatcttggtgccgactctctc gatactgtagagcttattatggagtttgaaaaggtttttgacatcaacatcgaggatgag gtgtctcaaaacatccagaccgttggcgacgctattagccacatccaagctgctatcgaa caaaagtaa

DBGET integrated database retrieval system