Porphyromonas somerae: CE91St14_20150 Help Entry CE91St14_20150    CDS       T08199                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism psoe  Porphyromonas somerae Pathway psoe00020   Citrate cycle (TCA cycle) psoe00720   Other carbon fixation pathways psoe01100   Metabolic pathways psoe01110   Biosynthesis of secondary metabolites psoe01120   Microbial metabolism in diverse environments psoe01200   Carbon metabolism psoe01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:psoe00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     CE91St14_20150   09102 Energy metabolism    00720 Other carbon fixation pathways     CE91St14_20150 Enzymes [BR:psoe01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      CE91St14_20150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_7 Fer4_6 Fer4_10 Fer4_9 Fer4_2 Fer4_16 LdpA_Fe-S-bd Fer4_15 Fer4_4 Fer4_13 Fer4_3 Fer4_17 Motif Other DBs NCBI-ProteinID:  BDE82987 LinkDB All DBs Position complement(2462961..2463191) Genome browser AA seq 76 aa AA seqDB search MTKTVKGTVVIDQVRCKGCNLCAVACPTGTLAMHPVEINDKGYHFSYMANPENCIGCANC GLVCPDACITVYRAKK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgactaagacagtaaaagggaccgtggtgatcgaccaagtgcgctgcaaggggtgtaac ctctgtgccgtggcttgcccgacaggtaccctagcaatgcaccctgtcgagatcaacgac aaagggtatcacttctcttatatggctaatcccgagaattgtatcgggtgtgccaattgc gggctagtatgccccgacgcatgtatcacagtctatagagctaagaagtaa

DBGET integrated database retrieval system