Phytophthora sojae: PHYSODRAFT_262605 Help Entry PHYSODRAFT_262605 CDS       T03459                                  Name (RefSeq) hypothetical protein   KO K10419   dynein light chain roadblock-type Organism psoj  Phytophthora sojae Pathway psoj04814   Motor proteins Brite KEGG Orthology (KO) [BR:psoj00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     PHYSODRAFT_262605  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psoj04131]     PHYSODRAFT_262605   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:psoj03037]     PHYSODRAFT_262605    04812 Cytoskeleton proteins [BR:psoj04812]     PHYSODRAFT_262605 Membrane trafficking [BR:psoj04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     PHYSODRAFT_262605 Cilium and associated proteins [BR:psoj03037]  Motile cilia and associated proteins   Dynein arm    PHYSODRAFT_262605 Cytoskeleton proteins [BR:psoj04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PHYSODRAFT_262605 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Robl_LC7 LAMTOR5 CHASE8 Motif Other DBs NCBI-GeneID:  20639397 NCBI-ProteinID:  XP_009525512 JGI:  Physo3_262605 UniProt:  G4ZD46 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MSEVEETLERIKNHKGVEGYVIADRNGNVLRRHPQMQVAEAEKYALYMKELTTKARGVVR DLNPKNDLQYMRIRVKKLELLIAHEMDFLVVVIQRWTPTNG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgtccgaggtggaggagacgctcgagcgcatcaagaaccacaagggtgtggagggctac gtgatcgccgaccgcaacggcaacgttcttcggcgtcacccgcagatgcaggtggcggag gctgaaaagtacgcgctctacatgaaggagctcactacgaaagcgcgaggcgtcgttcgc gacctgaaccccaagaacgacctgcagtacatgcgcatccgcgtcaaaaagctcgagctg ctgatcgcacacgagatggactttctagttgtcgtgatccagagatggacgccgacgaac ggatag

DBGET integrated database retrieval system