Phytophthora sojae: PHYSODRAFT_286504 Help Entry PHYSODRAFT_286504 CDS       T03459                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism psoj  Phytophthora sojae Pathway psoj03020   RNA polymerase psoj03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:psoj00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PHYSODRAFT_286504   09124 Replication and repair    03420 Nucleotide excision repair     PHYSODRAFT_286504  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:psoj03021]     PHYSODRAFT_286504    03400 DNA repair and recombination proteins [BR:psoj03400]     PHYSODRAFT_286504 Transcription machinery [BR:psoj03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      PHYSODRAFT_286504   RNA polymerase III system    RNA polymerase III      PHYSODRAFT_286504   RNA polymerase I system    RNA polymerase I      PHYSODRAFT_286504 DNA repair and recombination proteins [BR:psoj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PHYSODRAFT_286504 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  20640378 NCBI-ProteinID:  XP_009530254 JGI:  Physo3_286504 UniProt:  G4ZT08 LinkDB All DBs Position Unknown AA seq 72 aa AA seqDB search MIVPVRCFTCGKVLANKWETYLGLLRADYTERDALDELSLKRYCCRRMMLTHVDLIEKLL HYNTGAIERGDD NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgatcgtccctgtgcgctgcttcacgtgcggcaaggtgctggccaacaagtgggagacg tacctgggcctgctgcgcgccgactacacggagcgcgacgcgctggacgagctttcgctc aagcgctactgctgccgccgcatgatgctcacgcacgtggacctgatcgagaagctgctg cactacaacacgggcgccattgagagaggcgacgactga

DBGET integrated database retrieval system