Phytophthora sojae: PHYSODRAFT_310856 Help Entry PHYSODRAFT_310856 CDS       T03459                                  Name (RefSeq) hypothetical protein   KO K13113   ubiquitin-like protein 5 Organism psoj  Phytophthora sojae Brite KEGG Orthology (KO) [BR:psoj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:psoj03041]     PHYSODRAFT_310856   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:psoj04052]     PHYSODRAFT_310856 Spliceosome [BR:psoj03041]  Complex B   Other components    Complex B specific factors     PHYSODRAFT_310856 Cytokines and neuropeptides [BR:psoj04052]  Neuropeptides   Unclassified    PHYSODRAFT_310856 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 Crinkler OTU1_UBXL Motif Other DBs NCBI-GeneID:  20643330 NCBI-ProteinID:  XP_009518897 JGI:  Physo3_310856 UniProt:  G4YU54 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVILNDRLGKKIRVKCNEDDTVGDLKKLVAAQVGTRPEKIRIQKWYTIYKDHITLEDY EIHDGMGLELYYT NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtgatcctgaacgaccgcctgggcaagaagatccgcgtcaagtgcaacgag gacgacacggtgggggacctcaagaagctcgtggcggcgcaggtgggcacgcggccggag aagatccgcatccagaagtggtacaccatctacaaggaccacatcacgctcgaggactac gagattcacgacggcatggggctcgagctctactacacgtaa

DBGET integrated database retrieval system