Phytophthora sojae: PHYSODRAFT_335225 Help Entry PHYSODRAFT_335225 CDS       T03459                                  Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism psoj  Phytophthora sojae Pathway psoj03060   Protein export psoj04141   Protein processing in endoplasmic reticulum psoj04145   Phagosome Brite KEGG Orthology (KO) [BR:psoj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     PHYSODRAFT_335225    04141 Protein processing in endoplasmic reticulum     PHYSODRAFT_335225  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     PHYSODRAFT_335225  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psoj04131]     PHYSODRAFT_335225   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:psoj02044]     PHYSODRAFT_335225 Membrane trafficking [BR:psoj04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     PHYSODRAFT_335225 Secretion system [BR:psoj02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    PHYSODRAFT_335225 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  20646953 NCBI-ProteinID:  XP_009530877 JGI:  Physo3_335225 UniProt:  G4ZUH4 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MVRAAAAAYPPSVLRARAVGANGALAGKKPAPTASAEGAAASGLRNRRPVAAARSGQNTG RGMGGSTAGILRFYTDDSPGLKIGPTTVLVSCLMFVGFVVLLHVWGKFRG NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggtgcgtgcagcagcggcggcgtatcccccctccgtcctccgtgcgcgcgctgtggga gcgaacggagctttggcaggaaagaagcccgccccgacggcgtcagccgagggcgcggcg gccagcggcctgcgcaaccggcgcccggtggcggcggcgcgctcgggccagaacacgggc cgcggcatgggcggcagcacggccggcatcctgcgcttctacacggacgactcgcccggc ctcaagatcggccccacgacggtgctcgtgagctgcctcatgttcgtgggcttcgtggtg ctgctgcacgtgtggggcaagttccgcggctag

DBGET integrated database retrieval system