Phytophthora sojae: PHYSODRAFT_347005 Help Entry PHYSODRAFT_347005 CDS       T03459                                  Name (RefSeq) hypothetical protein   KO K19399   BBSome-interacting protein 1 Organism psoj  Phytophthora sojae Brite KEGG Orthology (KO) [BR:psoj00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:psoj03037]     PHYSODRAFT_347005 Cilium and associated proteins [BR:psoj03037]  Primary cilia and associated proteins   BBSome    PHYSODRAFT_347005 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  BBIP10 Motif Other DBs NCBI-GeneID:  20648840 NCBI-ProteinID:  XP_009530814 JGI:  Physo3_347005 UniProt:  G4ZUB1 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MQQRVQIQEVLPKAGLVYSERGNLTEVLCKPKIMPIKSATLLRIEEIEKQARALAKPATA NSPDYYRPGTSRK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgcagcagcgcgttcagatccaggaggtgctgcccaaggccggactcgtgtactcggag cgtggcaacttgactgaggtactctgcaagcccaagatcatgcccatcaagtcggcgacg ctgctgcgcatcgaggagatcgagaagcaggcgcgtgctctcgccaagccagcgactgcc aactcaccagactattaccgccctggtacatcgaggaaatga

DBGET integrated database retrieval system