Phytophthora sojae: PHYSODRAFT_353974 Help Entry PHYSODRAFT_353974 CDS       T03459                                  Name (RefSeq) hypothetical protein   KO K25829   transcription elongation factor 1 Organism psoj  Phytophthora sojae Brite KEGG Orthology (KO) [BR:psoj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:psoj03400]     PHYSODRAFT_353974 DNA repair and recombination proteins [BR:psoj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      Other TCR factor       PHYSODRAFT_353974 SSDB OrthologParalogGFIT Motif Pfam:  Zn_ribbon_Elf1 Ac81 DpnI Sina_RING C1_4 Motif Other DBs NCBI-GeneID:  20649508 NCBI-ProteinID:  XP_009519888 JGI:  Physo3_353974 UniProt:  G4YZC5 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search MGRRKKSTKKIQTRKKQVVSTVFKCPFCSHDEAVECKMDRERNIGHLSCRVCTESFQTPI HYLSAPIDVYTDWIDECEALNA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgggccgaaggaagaaatccaccaagaagatccagacgcgcaagaagcaggtcgtctcc accgtgttcaagtgccccttctgttcgcacgacgaggccgtcgagtgtaaaatggaccgc gagcgcaacatcggccacttgtcctgccgtgtgtgtaccgagagcttccagactcccatc cattatttgagcgcacccattgacgtgtacacggactggatcgacgagtgtgaggcgttg aatgcatag

DBGET integrated database retrieval system