Phytophthora sojae: PHYSODRAFT_355025 Help Entry PHYSODRAFT_355025 CDS       T03459                                  Name (RefSeq) hypothetical protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism psoj  Phytophthora sojae Pathway psoj03020   RNA polymerase psoj03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:psoj00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PHYSODRAFT_355025   09124 Replication and repair    03420 Nucleotide excision repair     PHYSODRAFT_355025  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:psoj03021]     PHYSODRAFT_355025    03400 DNA repair and recombination proteins [BR:psoj03400]     PHYSODRAFT_355025 Transcription machinery [BR:psoj03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      PHYSODRAFT_355025   RNA polymerase III system    RNA polymerase III      PHYSODRAFT_355025   RNA polymerase I system    RNA polymerase I      PHYSODRAFT_355025 DNA repair and recombination proteins [BR:psoj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PHYSODRAFT_355025 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb8 RNA_pol_RpbG Motif Other DBs NCBI-GeneID:  20649778 NCBI-ProteinID:  XP_009531265 JGI:  Physo3_355025 UniProt:  G4ZRM7 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search MATELFEDIFEVRQLNPDGKKFDKVTRVVCKGVSYELELTLDINSEVYRLRQNEKFTLAL VSTLDLEGKPDDGMFNQSGKPTLLDRYDYGMYGKVFQYDHEGGNMVAIYASFGGLLMCLR GEQRHLHMIHNDTRIYCLLRKQ NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atggcgaccgagctgtttgaggatatcttcgaggtgcggcagctgaacccggatggcaag aagttcgacaaagtgacccgcgtggtgtgcaagggtgtgtcgtacgagctggagctgacg ctggacatcaactcagaggtctaccgtctgcgccagaacgagaagttcacgctggcgctc gtcagcacgctggacctggagggcaagccggacgacggcatgttcaaccagtcgggcaag cccacgctgctggaccgttacgactacggcatgtacggcaaggtgttccagtacgaccac gagggcggcaacatggtggccatctacgccagcttcggcggcctgctcatgtgcctgcgc ggcgagcagcgccacctgcacatgattcacaacgacacacggatctactgcctgctccgg aaacagtaa

DBGET integrated database retrieval system