Phytophthora sojae: PHYSODRAFT_467796 Help Entry PHYSODRAFT_467796 CDS       T03459                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism psoj  Phytophthora sojae Pathway psoj03010   Ribosome psoj04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:psoj00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     PHYSODRAFT_467796   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     PHYSODRAFT_467796  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:psoj03011]     PHYSODRAFT_467796    04121 Ubiquitin system [BR:psoj04121]     PHYSODRAFT_467796 Ribosome [BR:psoj03011]  Ribosomal proteins   Eukaryotes    Large subunit     PHYSODRAFT_467796   Archaea     PHYSODRAFT_467796 Ubiquitin system [BR:psoj04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    PHYSODRAFT_467796 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  20653600 NCBI-ProteinID:  XP_009516195 JGI:  Physo3_467796 UniProt:  G4YMP5 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MHRYCSVVFKLITHVSEAVDCSDAYCNHLPLETTAFYSKFPGKQFEDGRTLSDYNIQKES TLHLVLRLRG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgcataggtactgtagtgtagtgttcaagttgattacccacgtttctgaggcagttgat tgcagtgatgcctattgtaatcatttgcctctcgagacaactgcgttttactcaaaattt ccaggcaagcagttcgaggacggccgcacgctgagcgactacaacatccagaaggagtcg actctccacctggtgctgcgtctgcgcggt

DBGET integrated database retrieval system