Phytophthora sojae: PHYSODRAFT_483342 Help Entry PHYSODRAFT_483342 CDS       T03459                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism psoj  Phytophthora sojae Pathway psoj04814   Motor proteins Brite KEGG Orthology (KO) [BR:psoj00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     PHYSODRAFT_483342  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:psoj03037]     PHYSODRAFT_483342    04812 Cytoskeleton proteins [BR:psoj04812]     PHYSODRAFT_483342 Cilium and associated proteins [BR:psoj03037]  Motile cilia and associated proteins   Dynein arm    PHYSODRAFT_483342 Cytoskeleton proteins [BR:psoj04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PHYSODRAFT_483342 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  20655612 NCBI-ProteinID:  XP_009518869 JGI:  Physo3_483342 UniProt:  G4YTI2 LinkDB All DBs Position Unknown AA seq 62 aa AA seqDB search MSTETNEQEIAAKVKQHFEQKYHGLLWHCCVGRNVACYVTHEQSKFLYFYIGQMAVVLFA TA NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgagtacggagacgaacgagcaggagatcgcggccaaggtgaagcagcacttcgagcag aaataccacggactcttgtggcactgctgcgtcgggcgcaacgtcgcgtgctacgtcacg cacgagcagtccaagttcctgtacttctacatcggtcagatggccgtcgtgctttttgcc accgcttaa

DBGET integrated database retrieval system