Phytophthora sojae: PHYSODRAFT_511442 Help Entry PHYSODRAFT_511442 CDS       T03459                                  Name (RefSeq) hypothetical protein   KO K01520   dUTP diphosphatase [EC:3.6.1.23] Organism psoj  Phytophthora sojae Pathway psoj00240   Pyrimidine metabolism psoj01100   Metabolic pathways psoj01232   Nucleotide metabolism Module psoj_M00938   Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP Brite KEGG Orthology (KO) [BR:psoj00001]  09100 Metabolism   09104 Nucleotide metabolism    00240 Pyrimidine metabolism     PHYSODRAFT_511442  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:psoj03400]     PHYSODRAFT_511442 Enzymes [BR:psoj01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.23  dUTP diphosphatase      PHYSODRAFT_511442 DNA repair and recombination proteins [BR:psoj03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     PHYSODRAFT_511442  Prokaryotic type     PHYSODRAFT_511442 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  dUTPase DCD Motif Other DBs NCBI-GeneID:  20659234 NCBI-ProteinID:  XP_009531789 JGI:  Physo3_511442 UniProt:  G4ZS64 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search MNTFRVQPDTTFIPTRKTKGAAGNDIKCAETTCIKAGQLKRVPTKCRMGIPEGHVGLLGG RSGHTSKGIEVKLGFIDEDYRGYVDVMVKNDTEEDFVINEGDRFAQLII NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgaacacgttcagagttcagcccgacacaacattcattcctactaggaaaaccaaaggg gctgctggaaacgatatcaagtgtgcggagaccacttgtatcaaagcaggacagctaaaa cgggtacctactaaatgcaggatgggaattcccgaaggacacgtaggacttcttggtgga cgatctggccatacatccaaaggtatcgaagtgaagctgggctttatcgatgaagattac agaggatacgtagacgtcatggtcaagaacgacaccgaagaagacttcgtcattaacgag ggagacagattcgctcaacttataatttga

DBGET integrated database retrieval system