Phytophthora sojae: PHYSODRAFT_519698 Help Entry PHYSODRAFT_519698 CDS       T03459                                  Name (RefSeq) hypothetical protein   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism psoj  Phytophthora sojae Pathway psoj03018   RNA degradation psoj03040   Spliceosome Brite KEGG Orthology (KO) [BR:psoj00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     PHYSODRAFT_519698   09123 Folding, sorting and degradation    03018 RNA degradation     PHYSODRAFT_519698  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:psoj03019]     PHYSODRAFT_519698    03041 Spliceosome [BR:psoj03041]     PHYSODRAFT_519698 Messenger RNA biogenesis [BR:psoj03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      PHYSODRAFT_519698   mRNA degradation factors    5'-3' decay     Lsm complex      PHYSODRAFT_519698 Spliceosome [BR:psoj03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     PHYSODRAFT_519698 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  20660209 NCBI-ProteinID:  XP_009534064 JGI:  Physo3_519698 UniProt:  G5A076 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search LVETISVITNDGRNIIGVLKGFDQCVNVILDDSFERVFSLKEPVEAVELGLYIVRGDNIS VIGGVPENIREQVIDDQTRAAPLKPLVH NT seq 267 nt NT seq  +upstreamnt  +downstreamnt cttgtagagaccatttcggtcatcacgaacgacggccgcaacatcatcggcgtgctcaag ggcttcgaccagtgcgtgaacgtgatcctggacgacagtttcgagcgcgtgttctcgctc aaggagccggtggaagccgtggagctcgggctctacatcgtgcgcggcgacaacatctcg gtgatcggcggcgtgcccgagaacatccgagagcaggtgatcgacgaccagacgcgtgcg gccccactaaagccgctcgtccattaa

DBGET integrated database retrieval system