Phytophthora sojae: PHYSODRAFT_523164 Help Entry PHYSODRAFT_523164 CDS       T03459                                  Name (RefSeq) hypothetical protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism psoj  Phytophthora sojae Pathway psoj03020   RNA polymerase psoj03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:psoj00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PHYSODRAFT_523164   09124 Replication and repair    03420 Nucleotide excision repair     PHYSODRAFT_523164  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:psoj03021]     PHYSODRAFT_523164    03400 DNA repair and recombination proteins [BR:psoj03400]     PHYSODRAFT_523164 Transcription machinery [BR:psoj03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      PHYSODRAFT_523164 DNA repair and recombination proteins [BR:psoj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PHYSODRAFT_523164 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L CorA Motif Other DBs NCBI-GeneID:  20660611 NCBI-ProteinID:  XP_009534261 JGI:  Physo3_523164 UniProt:  G5A3M7 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MNAPNRSDSYLLPEGAQKVTYEKDTKISNAGKFTILREDHTMGNLIRMQLLRDPNVMFSG YRHPHPLIHDITVRVQTNDASSPVEALANSLDDLSTEFDEIAQKFRRLTGNSKDPSSFS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgaacgcgccgaaccgcagcgactcgtacctgctgcccgagggcgcgcagaaggtgacg tacgagaaggacaccaagatctccaacgccggcaagttcaccatcctgcgcgaggaccac accatgggcaacctcatccgcatgcagctgctgcgcgacccgaacgtgatgttcagcggc taccgccacccgcacccgctcatccacgacatcaccgtgcgcgtgcagactaacgacgcg tcgtcgcccgtggaggcgctggccaactcgctggacgacctcagcaccgagttcgacgag atcgcgcagaagttccgccgtcttacaggcaactccaaggacccgagctccttcagttaa

DBGET integrated database retrieval system