Papaver somniferum (opium poppy): 113272569 Help Entry 113272569         CDS       T05758                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom03083   Polycomb repressive complex psom04120   Ubiquitin mediated proteolysis psom04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:psom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113272569    04120 Ubiquitin mediated proteolysis     113272569   09126 Chromosome    03083 Polycomb repressive complex     113272569  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113272569    04121 Ubiquitin system [BR:psom04121]     113272569    03036 Chromosome and associated proteins [BR:psom03036]     113272569 Membrane trafficking [BR:psom04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     113272569 Ubiquitin system [BR:psom04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      113272569    Cul7 complex      113272569 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      113272569   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      113272569 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Motif Other DBs NCBI-GeneID:  113272569 NCBI-ProteinID:  XP_026378171 LinkDB All DBs Position 1:233565481..233566353 Genome browser AA seq 113 aa AA seqDB search MAQQQPEKAVDSSIAIITMEAALAKIITLKSSGEQILAKIFSDMMQAAELLNIQGLIDLI KQKMADWMTGNTLEDIRRAFNLTDEEFQLTPEKDEEISRRLEIISRRRIVGAF NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcccaacaacagccagagaaagccgtcgattctagcattgcgatcatcaccatggaa gctgcactagcgaagataattactctgaagagctctggcgaacagatcttggcaaagatt ttttcagacatgatgcaggctgcggaacttctcaacatacagggattgatagatttgata aagcagaaaatggctgactggatgactggtaacacactagaggatattcgtcgggcattt aacttaacagacgaagaattccaactgacccctgaaaaagatgaagagattagtagaaga ttagagattattagtcgtaggcgaattgttggggccttttga

DBGET integrated database retrieval system