Papaver somniferum (opium poppy): 113272594 Help Entry 113272594         CDS       T05758                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom03083   Polycomb repressive complex psom04120   Ubiquitin mediated proteolysis psom04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:psom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113272594    04120 Ubiquitin mediated proteolysis     113272594   09126 Chromosome    03083 Polycomb repressive complex     113272594  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113272594    04121 Ubiquitin system [BR:psom04121]     113272594    03036 Chromosome and associated proteins [BR:psom03036]     113272594 Membrane trafficking [BR:psom04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     113272594 Ubiquitin system [BR:psom04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      113272594    Cul7 complex      113272594 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      113272594   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      113272594 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ SLATT_1 Motif Other DBs NCBI-GeneID:  113272594 NCBI-ProteinID:  XP_026378196 LinkDB All DBs Position 1:233600695..233601234 Genome browser AA seq 152 aa AA seqDB search MEAAPAKMITLKSSDEQIFLFDVTTITSNILAKMTTIPGNILAKVIDYCNKHAEVATSDE DKKIWDEQFLNLDFGTNAQIFLDMMQVAEFLNIQGLMDLISNKMAKWMTGKPLEDIRQAF NLTDEEFQITPEKDEEINRRLEFLSRRRMLGL NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggaagctgcaccagcgaagatgattactctgaagagctctgacgaacagatcttcctt ttcgacgtgactaccatcacaagcaatatcttggcaaagatgactaccatcccgggaaat atcttggcaaaggtaatcgactactgcaacaaacatgctgaggttgcgactagtgatgaa gataaaaagatctgggatgaacagtttttgaatttggattttggaacaaatgcccagata tttttagacatgatgcaggttgcggaatttctcaacatacagggattgatggacctgata tccaataaaatggccaagtggatgactggtaaaccactagaggatatacgccaggcattc aacttgacagacgaagaattccaaataacccctgaaaaagatgaagagattaataggaga ttagagtttcttagtcgtaggcgaatgttgggcctttga

DBGET integrated database retrieval system