KEGG   Papaver somniferum (opium poppy): 113288975
Entry
113288975         CDS       T05758                                 
Name
(RefSeq) SKP1-like protein 1B
  KO
K03094  S-phase kinase-associated protein 1
Organism
psom  Papaver somniferum (opium poppy)
Pathway
psom03083  Polycomb repressive complex
psom04120  Ubiquitin mediated proteolysis
psom04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:psom00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113288975
   04120 Ubiquitin mediated proteolysis
    113288975
  09126 Chromosome
   03083 Polycomb repressive complex
    113288975
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:psom04131]
    113288975
   04121 Ubiquitin system [BR:psom04121]
    113288975
   03036 Chromosome and associated proteins [BR:psom03036]
    113288975
Membrane trafficking [BR:psom04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    113288975
Ubiquitin system [BR:psom04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     113288975
   Cul7 complex
     113288975
Chromosome and associated proteins [BR:psom03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     113288975
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     113288975
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 113288975
NCBI-ProteinID: XP_026393920
LinkDB
Position
6:116015466..116017516
AA seq 155 aa
MSTEKKVTLKSSDGETFDVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC
KKHVENPKGDDRSADDELKNWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI
KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtcgactgaaaagaaagttacccttaagagttctgatggtgaaacctttgatgtcgat
gaggctgttgctcttgagtctcaaaccatcaagcatatgattgaagatgactgtgctgat
aatggaatccctctgcctaacgttactagcaagatcttggctaaggtgattgaatactgt
aagaagcatgtggagaatcctaagggagatgatcgttctgctgatgatgagcttaagaac
tgggatgctgagtttgtcaaggttgatcaggctaccttgttcgatcttatcttggctgcg
aactatttgaacatcaagagcttgttggacttaacttgccagacagttgctgacatgatc
aagggaaagacacctgaggagatccgtaagactttcaacatcaagaatgatttcacccct
gaggaagaggaggaggtcaggagggagaatcagtgggcctttgaatga

DBGET integrated database retrieval system