Papaver somniferum (opium poppy): 113290467 Help Entry 113290467         CDS       T05758                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom03083   Polycomb repressive complex psom04120   Ubiquitin mediated proteolysis psom04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:psom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113290467    04120 Ubiquitin mediated proteolysis     113290467   09126 Chromosome    03083 Polycomb repressive complex     113290467  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113290467    04121 Ubiquitin system [BR:psom04121]     113290467    03036 Chromosome and associated proteins [BR:psom03036]     113290467 Membrane trafficking [BR:psom04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     113290467 Ubiquitin system [BR:psom04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      113290467    Cul7 complex      113290467 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      113290467   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      113290467 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ RIX1 Motif Other DBs NCBI-GeneID:  113290467 NCBI-ProteinID:  XP_026395855 LinkDB All DBs Position 6:10810044..10810415 Genome browser AA seq 123 aa AA seqDB search MIEDCCDEIETPISLTNVSSKILEKALVFLEKHAEKEDEEKELKKWDQEFVDGFKDDQQT LFRMILAADYLAAKCLMGVTCQACADLVIGKSPEWIRKYFSIKNDFSPEEEEEVRRENQW AFE NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgattgaagattgttgtgatgaaattgagactccaatttcattaacaaatgtttccagt aagatcttggagaaagctcttgtgtttcttgagaagcatgctgagaaagaagatgaggaa aaggaactgaaaaagtgggatcaagaatttgttgatggtttcaaagatgatcagcagacc ctttttaggatgattcttgctgctgattatttggctgctaagtgtttgatgggtgtaact tgtcaagcctgtgctgatttggtaataggtaagtcacctgaatggattagaaagtatttc agtatcaagaatgattttagtcctgaagaagaagaggaagttagaagagagaatcagtgg gcatttgagtag

DBGET integrated database retrieval system