Papaver somniferum (opium poppy): 113290973 Help Entry 113290973         CDS       T05758                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom04145   Phagosome psom04148   Efferocytosis psom04517   IgSF CAM signaling psom04518   Integrin signaling psom04620   Toll-like receptor signaling pathway psom05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:psom00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     113290973    04518 Integrin signaling     113290973  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     113290973    04148 Efferocytosis     113290973  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113290973  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     113290973  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113290973   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psom04147]     113290973    04031 GTP-binding proteins [BR:psom04031]     113290973 Membrane trafficking [BR:psom04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     113290973  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     113290973   Macropinocytosis    Ras GTPases     113290973  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     113290973 Exosome [BR:psom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113290973   Exosomal proteins of other body fluids (saliva and urine)    113290973   Exosomal proteins of colorectal cancer cells    113290973   Exosomal proteins of bladder cancer cells    113290973 GTP-binding proteins [BR:psom04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     113290973 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  113290973 NCBI-ProteinID:  XP_026396341 LinkDB All DBs Position 1:75258897..75262015 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGSDVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELKKVIGAPAYIECSSKSQQNVKAVFDAAIKVVLQP PKQKKKKKAQKGNCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtctaggtttataaaatgtgttacggttggtgatggtgctgttggaaaaact tgtatgcttatttcttacaccagcaatactttccctacggattatgtgccaacggttttt gataatttcagcgcaaatgtggttgttgacggaagcacggttaatctaggattatgggat actgctgggcaagaggattacaatagattaagacctcttagttatcgtggatcggatgtt ttcctgttggctttctctctaattagtaaggcgagctatgaaaatgttgccaaaaagtgg attccggaattgaggcattatgcacctggtgttccgataattcttgttgggactaagctt gatcttcgagatgacaagcagttctttgtagaccaccccggtgcagtacccattaccaca gctcagggagaagaactgaaaaaggtgattggagctcctgcgtacatcgaatgtagctca aaatcgcagcagaatgtgaaagcagtctttgatgcagccatcaaagttgtgctccaacct cccaagcaaaagaagaagaagaaagctcaaaaagggaactgttccattctgtaa

DBGET integrated database retrieval system