Papaver somniferum (opium poppy): 113290973 Help Entry 113290973         CDS       T05758                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom04145   Phagosome psom04148   Efferocytosis psom04620   Toll-like receptor signaling pathway psom05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:psom00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     113290973    04148 Efferocytosis     113290973  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113290973  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     113290973  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113290973   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psom04147]     113290973    04031 GTP-binding proteins [BR:psom04031]     113290973 Membrane trafficking [BR:psom04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     113290973  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     113290973   Macropinocytosis    Ras GTPases     113290973  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     113290973 Exosome [BR:psom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113290973   Exosomal proteins of other body fluids (saliva and urine)    113290973   Exosomal proteins of colorectal cancer cells    113290973   Exosomal proteins of bladder cancer cells    113290973 GTP-binding proteins [BR:psom04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     113290973 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  113290973 NCBI-ProteinID:  XP_026396341 LinkDB All DBs Position 1:75258897..75262015 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGSDVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELKKVIGAPAYIECSSKSQQNVKAVFDAAIKVVLQP PKQKKKKKAQKGNCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcgtctaggtttataaaatgtgttacggttggtgatggtgctgttggaaaaact tgtatgcttatttcttacaccagcaatactttccctacggattatgtgccaacggttttt gataatttcagcgcaaatgtggttgttgacggaagcacggttaatctaggattatgggat actgctgggcaagaggattacaatagattaagacctcttagttatcgtggatcggatgtt ttcctgttggctttctctctaattagtaaggcgagctatgaaaatgttgccaaaaagtgg attccggaattgaggcattatgcacctggtgttccgataattcttgttgggactaagctt gatcttcgagatgacaagcagttctttgtagaccaccccggtgcagtacccattaccaca gctcagggagaagaactgaaaaaggtgattggagctcctgcgtacatcgaatgtagctca aaatcgcagcagaatgtgaaagcagtctttgatgcagccatcaaagttgtgctccaacct cccaagcaaaagaagaagaagaaagctcaaaaagggaactgttccattctgtaa

DBGET integrated database retrieval system