Papaver somniferum (opium poppy): 113291139 Help Entry 113291139         CDS       T05758                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom03083   Polycomb repressive complex psom04120   Ubiquitin mediated proteolysis psom04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:psom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113291139    04120 Ubiquitin mediated proteolysis     113291139   09126 Chromosome    03083 Polycomb repressive complex     113291139  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113291139    04121 Ubiquitin system [BR:psom04121]     113291139    03036 Chromosome and associated proteins [BR:psom03036]     113291139 Membrane trafficking [BR:psom04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     113291139 Ubiquitin system [BR:psom04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      113291139    Cul7 complex      113291139 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      113291139   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      113291139 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  113291139 NCBI-ProteinID:  XP_026396493 LinkDB All DBs Position 1:76227680..76229797 Genome browser AA seq 155 aa AA seqDB search MSTEKKVTLKSSDGETFDVDEAVALESQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC KKHVENPKGDDRSADDELKNWDAEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcgactgaaaagaaagttaccctcaagagttctgatggtgaaaccttcgatgttgat gaggctgttgctcttgagtctcaaaccatcaagcacatgattgaggatgactgtgctgat aatggaatccctctgcctaacgttactagcaagatcttggccaaggtgattgaatactgt aagaagcatgtggagaatcctaagggagatgatcgttctgctgatgatgagcttaagaac tgggatgctgagtttgtcaaggttgatcaggctaccttgttcgatcttatcttggcggcg aactatttgaacatcaagagcttgttggacctaacttgccagacagttgctgacatgatc aagggaaagacacctgaggagatccgtaagactttcaacatcaagaatgacttcacccct gaggaagaggaggaggtcaggagggagaaccagtgggcctttgaatga

DBGET integrated database retrieval system