Papaver somniferum (opium poppy): 113303148 Help Entry 113303148         CDS       T05758                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism psom  Papaver somniferum (opium poppy) Pathway psom04016   MAPK signaling pathway - plant psom04070   Phosphatidylinositol signaling system psom04075   Plant hormone signal transduction psom04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:psom00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     113303148    04070 Phosphatidylinositol signaling system     113303148    04075 Plant hormone signal transduction     113303148  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     113303148  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:psom01009]     113303148   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113303148    03036 Chromosome and associated proteins [BR:psom03036]     113303148   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psom04147]     113303148 Protein phosphatases and associated proteins [BR:psom01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      113303148 Membrane trafficking [BR:psom04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     113303148 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      113303148 Exosome [BR:psom04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    113303148 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M Dockerin_1 RNA_pol_Rpb4 EFhand_Ca_insen Caleosin FCaBP_EF-hand SPEF2_C SurA_N_3 Poly_export MotA_activ Fe_hyd_lg_C DUF6279 Motif Other DBs NCBI-GeneID:  113303148 NCBI-ProteinID:  XP_026407933 LinkDB All DBs Position 8:135907413..135910575 Genome browser AA seq 149 aa AA seqDB search MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADQ NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDD EVDEMIREADVDGDGQVNYEEFVRMMLAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagaacaactcactgaagagcagatctctgagtttaaggaagccttcagcctcttt gacaaagatggcgatggttgtatcaccaccaaagagttgggcacagtgatgagatctctg ggacaaaatcctactgaagctgaacttcaggacatgataaatgaagttgatgctgaccaa aatggaaccattgatttccctgagttcttgaatttgatggcacgaaaaatgaaggacact gactctgaggaggagctcaaggaggcattcaaggtctttgacaaggatcagaatggtttc atctcagctgcagagctaaggcatgtcatgacaaatcttggagaaaagttaacggatgat gaagtggacgagatgatccgagaagctgatgtggatggggacggtcaagtcaattatgag gaatttgtcaggatgatgcttgctaagtga

DBGET integrated database retrieval system