Papaver somniferum (opium poppy): 113304252 Help Entry 113304252         CDS       T05758                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism psom  Papaver somniferum (opium poppy) Pathway psom04016   MAPK signaling pathway - plant psom04070   Phosphatidylinositol signaling system psom04075   Plant hormone signal transduction psom04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:psom00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     113304252    04070 Phosphatidylinositol signaling system     113304252    04075 Plant hormone signal transduction     113304252  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     113304252  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:psom01009]     113304252   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113304252    03036 Chromosome and associated proteins [BR:psom03036]     113304252   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psom04147]     113304252 Protein phosphatases and associated proteins [BR:psom01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      113304252 Membrane trafficking [BR:psom04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     113304252 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      113304252 Exosome [BR:psom04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    113304252 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_5 EF-hand_7 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EH EF-hand_10 Dockerin_1 DUF2501 Motif Other DBs NCBI-GeneID:  113304252 NCBI-ProteinID:  XP_026409138 LinkDB All DBs Position 1:48673943..48674850 Genome browser AA seq 138 aa AA seqDB search MITEAGTGQNETIGFPRFRNMIARKLEYTVIAELEDLFKRVDTDHDGFISASEFLMLMNG VDETVIQALFQEADTDEDGQLNCEEFVRRSTWSSVCMSLDCIMSGMRRRGFDFSRIQNAP FASQLKNSVCVCILKQVL NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgataactgaagctggtactgggcaaaatgaaaccattggtttccctagattcaggaat atgattgcgagaaaacttgagtacactgtaattgcggagctggaggatttattcaagaga gttgacacggatcatgatggttttatctcagcctcagagtttttgatgctcatgaatggt gtggatgaaaccgtgatccaggcgttgttccaagaagctgacacggatgaagatggtcag ctcaactgcgaggagtttgtcaggagaagtacatggtcttcagtatgtatgagtttagac tgcatcatgtctggaatgaggaggaggggttttgacttttccaggatacagaatgcacct tttgcttcacaacttaagaacagcgtttgtgtgtgcattttgaaacaagtcctgtaa

DBGET integrated database retrieval system