Papaver somniferum (opium poppy): 113308546 Help Entry 113308546         CDS       T05758                                  Name (RefSeq) protein MHF1 homolog   KO K11511   centromere protein S Organism psom  Papaver somniferum (opium poppy) Pathway psom03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:psom00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     113308546  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psom03036]     113308546    03400 DNA repair and recombination proteins [BR:psom03400]     113308546 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      113308546 DNA repair and recombination proteins [BR:psom03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      113308546 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C TFIID-31kDa Bromo_TP DUF1175 Sec7-like_HUS CBFD_NFYB_HMF DUF6989 Motif Other DBs NCBI-GeneID:  113308546 NCBI-ProteinID:  XP_026412796 LinkDB All DBs Position 9:complement(28596224..28598405) Genome browser AA seq 135 aa AA seqDB search MDERDDSDFEREEEEESTRNVLKDRFRLSVIKIAEAEGKKNNMEVSEQVMGCISDLAFKF SEQLAKDLELFAQHAGRKSVNMDDVILSAHRNEHLASSLRLFSSELKGKEPQPEKKRKKT SKKEDKTPSAALHIS NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atggatgaaagagacgacagtgatttcgagagagaagaagaagaagaatcaactaggaat gtcttgaaagatagattccgcctttctgttatcaaaattgctgaagctgagggcaagaag aacaatatggaggtatctgagcaagtcatgggttgtatttctgatcttgccttcaaattt tcagaacagttggccaaggacctagagctatttgcacagcatgcaggtcgcaagtctgtg aacatggacgatgttatactttctgcccataggaacgaacatctggcctcgtcattgagg cttttcagctctgaattgaaggggaaagaaccccaacctgagaagaagcggaagaaaact tcaaagaaggaagacaaaactccctctgcggcacttcatatatcatga

DBGET integrated database retrieval system