Papaver somniferum (opium poppy): 113325856 Help Entry 113325856         CDS       T05758                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom03083   Polycomb repressive complex psom04120   Ubiquitin mediated proteolysis psom04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:psom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113325856    04120 Ubiquitin mediated proteolysis     113325856   09126 Chromosome    03083 Polycomb repressive complex     113325856  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113325856    04121 Ubiquitin system [BR:psom04121]     113325856    03036 Chromosome and associated proteins [BR:psom03036]     113325856 Membrane trafficking [BR:psom04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     113325856 Ubiquitin system [BR:psom04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      113325856    Cul7 complex      113325856 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      113325856   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      113325856 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ SR1P Motif Other DBs NCBI-GeneID:  113325856 NCBI-ProteinID:  XP_026429509 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MIEDCGTGNDIPVPLTNISSEILEIVLAFLEKHASEEEDRDEDENQELKNCQACADLIKH FPPEKISKIFNIKNDFTPKEEAEVRRENAWDFE NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgattgaagattgtggtactggaaatgatattccagttccattaaccaatatttcaagt gagattttagagattgttcttgcatttcttgagaaacatgctagtgaggaagaagataga gatgaagatgagaaccaagaactgaaaaattgccaagcctgtgctgatttgatcaaacat tttccaccagaaaagattagcaagattttcaatatcaagaatgattttacccctaaagaa gaagcagaagttagaagagagaatgcttgggattttgagtag

DBGET integrated database retrieval system