Papaver somniferum (opium poppy): 113328401 Help Entry 113328401         CDS       T05758                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism psom  Papaver somniferum (opium poppy) Pathway psom04136   Autophagy - other Brite KEGG Orthology (KO) [BR:psom00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     113328401  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113328401    04121 Ubiquitin system [BR:psom04121]     113328401    03029 Mitochondrial biogenesis [BR:psom03029]     113328401 Membrane trafficking [BR:psom04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     113328401 Ubiquitin system [BR:psom04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    113328401 Mitochondrial biogenesis [BR:psom03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     113328401 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 DUF4264 Motif Other DBs NCBI-GeneID:  113328401 NCBI-ProteinID:  XP_026431299 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MATESPNSSRKVVVHLRATGDAPILKQAKFKIAGTDKFAKVIDFLRRQLHRDTLFVYVNS AFSPNPDELVNDLYNNFGFDGKLVVNYACSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctacagaatcaccaaattcgtctcgtaaagttgtggttcatcttagggcaactggt gatgctccaatacttaaacaagcaaagttcaagatagcaggaactgataaatttgctaaa gtaattgattttcttcgtagacaacttcaccgagatacactatttgtgtatgtaaatagc gctttttcgcctaaccctgacgaattagtgaatgatctttacaataattttgggtttgat ggaaaactggtggtgaactatgcttgctcaatggcctggggctaa

DBGET integrated database retrieval system