Papaver somniferum (opium poppy): 113329250 Help Entry 113329250         CDS       T05758                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom03083   Polycomb repressive complex psom04120   Ubiquitin mediated proteolysis psom04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:psom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113329250    04120 Ubiquitin mediated proteolysis     113329250   09126 Chromosome    03083 Polycomb repressive complex     113329250  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113329250    04121 Ubiquitin system [BR:psom04121]     113329250    03036 Chromosome and associated proteins [BR:psom03036]     113329250 Membrane trafficking [BR:psom04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     113329250 Ubiquitin system [BR:psom04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      113329250    Cul7 complex      113329250 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      113329250   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      113329250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 MCM_C Motif Other DBs NCBI-GeneID:  113329250 NCBI-ProteinID:  XP_026431995 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MSTSKMVTLKSSDGETFDVEESVALQSQTIKHMIEDDCADNGIPLPNVTSKILAKVIEYC KKHDGDADEKKKDDELKNWDAEFVKVDQATLFDLTLAANYLNIMELLDLTCQTVADMIKD KTPEEIRKTFNIENDFTPEEEEEVRRENQWAFE NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgtcgacttcaaagatggtaaccttgaagagttctgatggagaaacttttgatgttgaa gaatccgttgctcttcaatctcaaaccattaagcatatgatcgaagatgattgtgctgat aacggaatacctttacccaatgtaacaagcaagattttggctaaagttattgaatactgc aagaaacatgacggtgatgccgatgaaaaaaagaaagatgatgaacttaagaactgggat gctgagtttgttaaggtcgatcaagctacgttgttcgatcttactttggctgcaaattat ctgaatattatggagttgttggatttgacttgccagactgtggctgatatgatcaaggat aagacaccagaggagatccgcaagacattcaacatcgagaatgacttcacccctgaggaa gaggaggaggtcagaagggagaaccagtgggcttttgaatga

DBGET integrated database retrieval system