Papaver somniferum (opium poppy): 113330651 Help Entry 113330651         CDS       T05758                                  Name (RefSeq) rac-like GTP-binding protein 6   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom04145   Phagosome psom04148   Efferocytosis psom04517   IgSF CAM signaling psom04518   Integrin signaling psom04620   Toll-like receptor signaling pathway psom05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:psom00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     113330651    04518 Integrin signaling     113330651  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     113330651    04148 Efferocytosis     113330651  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113330651  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     113330651  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113330651   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psom04147]     113330651    04031 GTP-binding proteins [BR:psom04031]     113330651 Membrane trafficking [BR:psom04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     113330651  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     113330651   Macropinocytosis    Ras GTPases     113330651  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     113330651 Exosome [BR:psom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113330651   Exosomal proteins of other body fluids (saliva and urine)    113330651   Exosomal proteins of colorectal cancer cells    113330651   Exosomal proteins of bladder cancer cells    113330651 GTP-binding proteins [BR:psom04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     113330651 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  113330651 NCBI-ProteinID:  XP_026433260 LinkDB All DBs Position Unknown AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELKKVIGAPYYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKAQKGGCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttctaggtttataaagtgcgtcactgtcggagatggtgctgtcggtaaaact tgcatgttgatttcctataccagcaacacatttcccacggattatgtgccgactgttttt gacaatttcagtgcaaatgtggttgtcgatggaaatactgttaaccttggattatgggat actgctggtcaggaggattacaatagattaagacctctgagttatcgaggtgcagatgtt ttcctgttggcattctctctcattagcaaggctagctatgaaaatgttgccaagaagtgg attcctgaactaaggcattatgcacctggtgttccaattattcttgtgggaacaaagctt gatctccgggatgataaacaattctttgttgaccaccctggtgctgtccctattactaca gctcagggagaggagttaaagaaggtgattggagctccttactatattgagtgtagttct aagacacaacagaatgtcaaggcagtcttcgatgcagcaattaaggtggtgctccagcca ccgaagcaaaagaagaagaagaaagcgcaaaagggaggctgctccattttgtga

DBGET integrated database retrieval system