Papaver somniferum (opium poppy): 113336047 Help Entry 113336047         CDS       T05758                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom03083   Polycomb repressive complex psom04120   Ubiquitin mediated proteolysis psom04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:psom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113336047    04120 Ubiquitin mediated proteolysis     113336047   09126 Chromosome    03083 Polycomb repressive complex     113336047  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113336047    04121 Ubiquitin system [BR:psom04121]     113336047    03036 Chromosome and associated proteins [BR:psom03036]     113336047 Membrane trafficking [BR:psom04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     113336047 Ubiquitin system [BR:psom04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      113336047    Cul7 complex      113336047 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      113336047   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      113336047 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  113336047 NCBI-ProteinID:  XP_026437828 LinkDB All DBs Position 1:208658527..208668429 Genome browser AA seq 147 aa AA seqDB search MSTAKMVTFKSSDGETFDVEESVALQSQTINHMTEDNCANNGIPLPNVTIKILAKVVEYC RKHDDPTNDKDKDLKDWDAEFVKVDQATLFDHILAANYLNIKSLLDLTCQTLADMIKGKT PKEIRKTFNIKNELHPKEEEEVRREHP NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgtcgactgcaaagatggtaaccttcaagagttccgatggagaaacttttgatgttgaa gaatctgttgctcttcaatctcaaaccattaatcatatgaccgaagataattgtgctaat aacggaatacctttacccaatgtaactatcaagattttggctaaagttgttgaatactgc aggaaacatgatgatcctaccaatgataaagacaaagatctcaaggactgggatgctgag tttgttaaggtcgatcaagctacgttgttcgatcatattttggctgcaaattatctgaat attaagagtttgttggatttgacttgccagacccttgctgatatgatcaaaggtaagacc ccaaaggagatccgcaagacattcaacattaagaatgaacttcaccctaaggaagaggag gaggtccgaagggagcacccgtga

DBGET integrated database retrieval system