Papaver somniferum (opium poppy): 113343901
Help
Entry
113343901 CDS
T05758
Name
(RefSeq) SKP1-like protein 1A
KO
K03094
S-phase kinase-associated protein 1
Organism
psom
Papaver somniferum (opium poppy)
Pathway
psom03083
Polycomb repressive complex
psom04120
Ubiquitin mediated proteolysis
psom04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
psom00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
113343901
04120 Ubiquitin mediated proteolysis
113343901
09126 Chromosome
03083 Polycomb repressive complex
113343901
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
psom04131
]
113343901
04121 Ubiquitin system [BR:
psom04121
]
113343901
03036 Chromosome and associated proteins [BR:
psom03036
]
113343901
Membrane trafficking [BR:
psom04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
113343901
Ubiquitin system [BR:
psom04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
113343901
Cul7 complex
113343901
Chromosome and associated proteins [BR:
psom03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
113343901
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
113343901
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
113343901
NCBI-ProteinID:
XP_026443779
LinkDB
All DBs
Position
Unknown
AA seq
181 aa
AA seq
DB search
MSTSETITLRSSDGEDFVVEEDIALQYEYVKKYMRDKCVIDNTIPIPLTSSKVLAKVVEY
CKKHAESPRGDDGKTEEELLKTWDAEFVNVDLYTFLEIMFAAKLLGIKNLEDFVDQKAAT
MIMTMLDKVKKIFGVIGEIFQMFGKVYNFLKARPSGSILWDNVWETAMVEQGIGAFPQSD
S
NT seq
546 nt
NT seq
+upstream
nt +downstream
nt
atgtctacttcagagaccataaccttaaggagtagtgatggagaagattttgtggtcgaa
gaagatattgctcttcaatatgaatatgttaagaaatatatgcgagacaaatgtgttatc
gacaacacaataccaatacccctcacatcaagcaaggttttggctaaagttgtcgaatac
tgcaagaaacatgctgaaagtcctcgaggggacgatggtaaaactgaggaagagctactg
aagacttgggatgctgaatttgttaacgtcgacttgtatacattcttagaaattatgttt
gctgcaaaattgttgggtattaaaaacttagaggattttgttgatcagaaagctgccaca
atgatcatgacaatgttggataaagttaaaaagatattcggggtgatcggggaaattttc
cagatgttcggtaaagtttataattttttgaaagcgagaccttctggtagtatattatgg
gacaacgtctgggaaaccgcaatggtagaacagggcattggggcatttccacaatctgat
tcttag
DBGET
integrated database retrieval system