Papaver somniferum (opium poppy): 113346771 Help Entry 113346771         CDS       T05758                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom03083   Polycomb repressive complex psom04120   Ubiquitin mediated proteolysis psom04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:psom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113346771    04120 Ubiquitin mediated proteolysis     113346771   09126 Chromosome    03083 Polycomb repressive complex     113346771  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113346771    04121 Ubiquitin system [BR:psom04121]     113346771    03036 Chromosome and associated proteins [BR:psom03036]     113346771 Membrane trafficking [BR:psom04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     113346771 Ubiquitin system [BR:psom04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      113346771    Cul7 complex      113346771 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      113346771   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      113346771 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  113346771 NCBI-ProteinID:  XP_026446066 LinkDB All DBs Position 1:complement(84344074..84344496) Genome browser AA seq 140 aa AA seqDB search MVGKENRKIVISYSITGEILSKVVEYLSKHAETQTSEEELKIWDEQFVNLFNNNHIVFDV IKAASYLQVEGLVNLLKKGVADFLKAKTPEALRGKFAICNQLDLPGEEEGDEERISQSST EQLSPDKKKVKIEFCSSGEE NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggtgggcaaggaaaataggaagattgttatcagttattctataacaggcgaaatattg tccaaggtagttgagtatctcagcaaacacgctgagacccagactagcgaagaagaactg aagatatgggatgaacaattcgtcaatttatttaataataaccacatagtgttcgacgtg atcaaggcagcaagttatcttcaggtagagggcttggtgaacttgttgaaaaagggagtg gcagatttccttaaggctaaaacacctgaggcgttgcgcgggaaattcgccatttgtaac caactcgatctccccggagaagaagaaggagatgaagagagaatttctcagagcagcacg gagcaactctcccccgacaaaaagaaggtgaagattgaattttgcagcagcggcgaggaa taa

DBGET integrated database retrieval system