Papaver somniferum (opium poppy): 113352308 Help Entry 113352308         CDS       T05758                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom03083   Polycomb repressive complex psom04120   Ubiquitin mediated proteolysis psom04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:psom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113352308    04120 Ubiquitin mediated proteolysis     113352308   09126 Chromosome    03083 Polycomb repressive complex     113352308  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113352308    04121 Ubiquitin system [BR:psom04121]     113352308    03036 Chromosome and associated proteins [BR:psom03036]     113352308 Membrane trafficking [BR:psom04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     113352308 Ubiquitin system [BR:psom04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      113352308    Cul7 complex      113352308 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      113352308   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      113352308 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 RIC1 Motif Other DBs NCBI-GeneID:  113352308 NCBI-ProteinID:  XP_026451929 LinkDB All DBs Position 2:complement(156572336..156572719) Genome browser AA seq 127 aa AA seqDB search MANRKITLKSCDGEIFDVDEAVALQSRTIKHIIEDGCADNAIPLPNVKSQTLAKVIAYCK KHVETSEGNGRREDLDKWDAVFVKVGQYTLFEYILAANYLDIKSKYFNIKNDFTPEEEEE EVRNKAF NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atggcaaacagaaagataaccttgaagagttgtgatggagaaatttttgatgttgatgaa gctgttgctcttcaatctcgaaccattaaacatataattgaagatggttgtgctgataat gctatacctttaccaaacgtgaaaagccagacgttggctaaagttattgcgtattgcaag aaacacgttgaaacctctgaagggaatggtcgtcgtgaagatcttgacaagtgggatgct gtttttgttaaagtcggtcagtataccctgtttgaatatatcttagctgcaaattatttg gatatcaagagcaaatatttcaacattaagaatgacttcaccccagaggaagaagaggag gaggttaggaacaaggctttctaa

DBGET integrated database retrieval system