Papaver somniferum (opium poppy): 113357193 Help Entry 113357193         CDS       T05758                                  Name (RefSeq) rac-like GTP-binding protein 6   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom04145   Phagosome psom04148   Efferocytosis psom04517   IgSF CAM signaling psom04518   Integrin signaling psom04620   Toll-like receptor signaling pathway psom05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:psom00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     113357193    04518 Integrin signaling     113357193  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     113357193    04148 Efferocytosis     113357193  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     113357193  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     113357193  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113357193   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psom04147]     113357193    04031 GTP-binding proteins [BR:psom04031]     113357193 Membrane trafficking [BR:psom04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     113357193  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     113357193   Macropinocytosis    Ras GTPases     113357193  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     113357193 Exosome [BR:psom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113357193   Exosomal proteins of other body fluids (saliva and urine)    113357193   Exosomal proteins of colorectal cancer cells    113357193   Exosomal proteins of bladder cancer cells    113357193 GTP-binding proteins [BR:psom04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     113357193 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  113357193 NCBI-ProteinID:  XP_026456305 LinkDB All DBs Position 3:complement(121070860..121075070) Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELKKVIGAPYYIECSSKTQQNVKAVFDAAIKVVLQP PKQKKKKKAQKGGCSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttctaggtttataaagtgcgtcactgtcggagatggtgctgtcggtaaaact tgcatgttgatttcctacaccagcaacacatttcccacggattatgtgccgactgttttt gacaatttcagtgcaaatgtggttgtagatggaaatactgttaaccttggattatgggat actgctggtcaggaggattataatagattaagacctctaagttatcgaggtgcagatgtt ttcctgttggcattctctctcattagcaaggctagctatgaaaatgttgccaagaagtgg attcctgaactaaggcattatgcacctggtgttccaattattctcgtgggaacaaagctt gatctccgggatgataaacaattctttgttgaccaccctggtgccgtccctattactaca gctcagggagaggagttaaagaaggtgattggagctccttactatattgagtgtagttct aagacacaacagaatgtcaaggcagtcttcgatgcagcaattaaggtggtgctccagcca ccgaagcaaaagaagaagaagaaagcgcaaaagggaggctgctccattttgtga

DBGET integrated database retrieval system