Papaver somniferum (opium poppy): 113359629 Help Entry 113359629         CDS       T05758                                  Name (RefSeq) SKP1-like protein 4   KO K03094   S-phase kinase-associated protein 1 Organism psom  Papaver somniferum (opium poppy) Pathway psom03083   Polycomb repressive complex psom04120   Ubiquitin mediated proteolysis psom04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:psom00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     113359629    04120 Ubiquitin mediated proteolysis     113359629   09126 Chromosome    03083 Polycomb repressive complex     113359629  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:psom04131]     113359629    04121 Ubiquitin system [BR:psom04121]     113359629    03036 Chromosome and associated proteins [BR:psom03036]     113359629 Membrane trafficking [BR:psom04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     113359629 Ubiquitin system [BR:psom04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      113359629    Cul7 complex      113359629 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      113359629   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      113359629 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  113359629 NCBI-ProteinID:  XP_026459013 LinkDB All DBs Position 3:complement(75694239..75694664) Genome browser AA seq 141 aa AA seqDB search MITLKSCDKKFFVIEETVALQSKTLKRMMAGNENDEHILVPLTTIKGNVLAEVLDYCTKH AEVETSEEDKKIWDAQFVNFELDDETNSRMLLDMFQAAKFLNIEGLMDLTREKASEWMPR KTPEAKEAILRRIENHRQLND NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgattactttgaagagttgtgacaaaaagttctttgttattgaggagaccgttgccttg caatctaaaactctgaagcgcatgatggctggtaacgagaatgatgagcatattcttgtc cctttgactaccatcaaaggcaatgtcttggcagaggtgctcgactactgcaccaaacat gctgaggttgagactagtgaggaagataaaaagatttgggatgcacagtttgtgaatttc gaacttgatgatgaaacaaattcccggatgttactagatatgttccaagctgccaagttt cttaacatagagggattgatggacttgacaagagagaaagcttctgaatggatgcctcgt aaaacaccagaggcgaaagaagcgattcttagacgtatagagaatcataggcagttgaat gattaa

DBGET integrated database retrieval system