Papaver somniferum (opium poppy): 113362091 Help Entry 113362091         CDS       T05758                                  Name (RefSeq) histone H3.3-like   KO K11253   histone H3 Organism psom  Papaver somniferum (opium poppy) Brite KEGG Orthology (KO) [BR:psom00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:psom03036]     113362091   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:psom04147]     113362091 Chromosome and associated proteins [BR:psom03036]  Eukaryotic type   Nucleosome assembly factors    Histones     113362091 Exosome [BR:psom04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113362091 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  113362091 NCBI-ProteinID:  XP_026460866 LinkDB All DBs Position 3:214020019..214020486 Genome browser AA seq 99 aa AA seqDB search MAYTEHTARKSTGGKAPRKQLATKTTCKCAPTTGGVNKPHRYHPGTVALRGMCKCHKSTE LMFMKLPFQRPLREIAQEFNTDLRFRSHAVLALQEASEA NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggcatatactgagcacactgctcgtaagtcaactggaggtaaggcaccaaggaagcaa ctagctaccaagactacatgtaagtgtgcaccaactactggtggagttaataagccacat cgataccatcctggaactgttgctcttcgtggaatgtgtaagtgccataagagtactgaa ttgatgttcatgaaacttccattccagagacctcttcgtgaaattgcccaggagttcaat actgatttacggttccggagtcatgctgtgttggcattgcaagaagcatctgaagcctaa

DBGET integrated database retrieval system