Papaver somniferum (opium poppy): 26895674 Help Entry 26895674          CDS       T05758                                  Symbol atpH, AZ395_gp080 Name (RefSeq) ATP synthase CF0 C subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism psom  Papaver somniferum (opium poppy) Pathway psom00190   Oxidative phosphorylation psom00195   Photosynthesis psom01100   Metabolic pathways Module psom_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:psom00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     26895674 (atpH)    00195 Photosynthesis     26895674 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:psom00194]     26895674 (atpH) Photosynthesis proteins [BR:psom00194]  Photosystem and electron transport system   F-type ATPase [OT]    26895674 (atpH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  26895674 NCBI-ProteinID:  YP_009234969 UniProt:  A0A125R3A8 LinkDB All DBs Position Pltd:complement(13461..13706) Genome browser AA seq 81 aa AA seqDB search MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatccactgatttctgccgcttccgttattgctgctggattggccgtagggcttgct tctattggacccggagttggtcaaggtactgctgcgggacaagccgtagaaggtattgcg agacaaccagaggcagagggtaaaatacgaggtactttattgctgagtctggcttttatg gaagctttaacaatttatgggttggttgtggcattagcacttttatttgcgaatcctttt gtttaa

DBGET integrated database retrieval system