KEGG   Paenibacillus sophorae: KP014_03000
Entry
KP014_03000       CDS       T07500                                 
Symbol
cydD
Name
(GenBank) thiol reductant ABC exporter subunit CydD
  KO
K16013  ATP-binding cassette, subfamily C, bacterial CydD
Organism
psop  Paenibacillus sophorae
Pathway
psop02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:psop00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    KP014_03000 (cydD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psop02000]
    KP014_03000 (cydD)
Transporters [BR:psop02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    KP014_03000 (cydD)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_21 AAA_29 AAA_23 RsgA_GTPase MMR_HSR1 AAA_16 MeaB AAA_22
Other DBs
NCBI-ProteinID: QWU16257
UniProt: A0A1H8TL49
LinkDB
Position
complement(623658..625550)
AA seq 630 aa
MDRNLLGYKGVRPAFLAVGFLTLVQSLSILLLAASLAEVISALFAGKPLKEQWGTALLFL
LAFLARHACGLLMSSISYRFAEKTGSAMRREMMDRLFRLGPRMAGDQGTGTLVTLVLEGV
TKFRTYLELIIPRMVGMAVTPVLLLVYVYTQDSMSGIILTVTMPIIIVFMILIGMTARKQ
MDRQLESYRTLSNHFVDSLRGLETLKFLGRSKDHSQAIAEVSDRYRSATMRTLRVAFLSS
FALDFFTMLSVASVAVSLGVRLVNGDMTLVTGLTILILAPEYFLPVRLVGADFHATLDGK
EAGEAMKGIIDREPVKAVALERGASALTDAPAGDEGLPEDRSGAEDTEYASAGRPGGNPS
VGGRSAAVSGQSASVLLESAFAWNGSSMLSLQGIGVRHEEGGPSSLEEISLQFTGTGKIG
IIGESGAGKSTLIDVLAGFLHPGVGSITINGCEVSALTDDAWRRQTSYIPQRPYIFSGTL
ADNVRFYYPEAPLAAISRAVAAAGLSPLAASLPDGLDERIGGGGRSLSGGQEQRVALARA
LLSSRPIMLLDEPTAHLDIETEYELKETMLPLFEDKLVFLATHRLHWMADMDRIIVMKQG
RVAEVGTHQELLERKGTYYELVEAQLEGIH
NT seq 1893 nt   +upstreamnt  +downstreamnt
atggatagaaatttgcttgggtataaaggagtgaggccggcctttctggcggtaggcttc
cttaccctggtgcaaagcttgtccatcctgctgctagccgcatcgctggcagaagttatc
tccgcgctgttcgcggggaagccgctgaaggaacaatggggcactgcgctgttgttcctt
cttgcgtttctggcgcggcatgcctgcggactgctgatgagcagtatctcgtaccggttc
gccgagaagacgggcagcgccatgcggcgtgagatgatggacaggctgttccggctgggg
ccgagaatggccggggatcaaggaacgggaaccttggtgacgctcgtactggagggagtg
acgaagttccgcacctacttggagctgattattccgcgcatggtcggcatggcggtaacg
ccagtgctgctgctcgtttatgtgtacacacaggacagtatgagcgggattattctaacc
gtgacgatgccgattattatcgtattcatgattctgatcggcatgacagcccgtaagcag
atggaccggcagctggaatcgtaccggacgctgtccaatcactttgtggactcgctgcgg
gggcttgagacgctgaaatttctcgggcgaagcaaggaccacagccaggccatcgcggag
gtcagcgaccgctaccggtcggcaacgatgcgcacgctgcgtgtggcgttcctgtcatcg
ttcgcgcttgatttcttcaccatgctgtccgttgcttccgtggccgtcagtctcggcgtg
cggctggtgaacggcgatatgacgctggttacgggactgacgattctaatcctggcgccg
gaatatttcctgccggtgcggctggtcggcgccgactttcacgccacgcttgacggcaag
gaagcgggtgaagcgatgaagggcattattgaccgtgaacctgtaaaggcggtagcgcta
gagcgtggggcatcagctttgacggatgctccggcaggagatgaggggctgccggaagat
cgctccggggcagaggacacggagtatgcttcggcgggcagaccgggtgggaatccctcc
gtcggcgggaggtctgcggcagtctccggtcaaagcgcttctgtcttgctggagtcggca
tttgcctggaatggcagcagtatgctgtctctccaggggatcggggtacggcatgaagaa
ggcggcccttcctcgctggaggagattagtttgcagttcaccggcaccggcaaaatcggc
atcatcggcgaaagcggcgccggaaaatcgacgctgattgatgtgctggccgggtttttg
cacccgggcgtggggagcataacgattaacggctgcgaggtgagcgcgctgaccgacgac
gcctggcggcgccagacgtcatatattccgcagcggccgtacattttcagcggaacgctg
gcggataatgtccggttctactacccggaggctccgcttgctgctatttccagagctgtc
gccgctgccggactgtcgccgcttgccgcctcgctgcctgatggactggatgaaaggatt
ggcggcggaggacgttccttaagcggcggacaagagcagcgggtcgcgctggcgcgggcg
ctgctgagcagccgtccgatcatgctgctggacgaaccgacggcgcatctggatatcgag
acggaatatgagctgaaggaaacgatgctgccgctgtttgaggacaagcttgtctttctg
gctacgcatcgtctgcactggatggcggacatggaccgcattattgttatgaagcagggc
agggttgccgaagtgggcacccatcaggagcttcttgaacgcaaaggaacctattacgag
cttgtagaagcgcaactggaggggattcattga

DBGET integrated database retrieval system