Paenibacillus sophorae: KP014_08580 Help Entry KP014_08580       CDS       T07500                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism psop  Paenibacillus sophorae Brite KEGG Orthology (KO) [BR:psop00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:psop03110]     KP014_08580 (groES)    03029 Mitochondrial biogenesis [BR:psop03029]     KP014_08580 (groES) Chaperones and folding catalysts [BR:psop03110]  Heat shock proteins   HSP10    KP014_08580 (groES) Mitochondrial biogenesis [BR:psop03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     KP014_08580 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 OB_DPOA2 Motif Other DBs NCBI-ProteinID:  QWU17203 UniProt:  A0A1H8VKB1 LinkDB All DBs Position 1841155..1841436 Genome browser AA seq 93 aa AA seqDB search MIKPLGERVLVEPIEQEETTSFGIVLPDSAKEKPQEGKIVAVGSGALKDGVRVPLEVKEG DRVIFSKYAGTEIKYEGKEYLIMKESDIHAILG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgatcaaacctttaggtgaacgcgtactggtggaaccgatcgagcaggaggaaacgact tcgttcggtatcgtgcttccggactctgccaaggagaagccgcaggaaggcaaaatcgtg gccgtaggcagcggcgctctgaaagacggagttcgcgtaccgctggaagtaaaggaaggc gaccgcgtgattttctcgaagtatgcgggaaccgaaatcaagtatgaaggcaaagaatat ttgattatgaaagaaagcgacattcacgcgattctgggttaa

DBGET integrated database retrieval system