KEGG   Paenibacillus sophorae: KP014_15900
Entry
KP014_15900       CDS       T07500                                 
Name
(GenBank) calcium-translocating P-type ATPase, SERCA-type
  KO
K01537  P-type Ca2+ transporter type 2C [EC:7.2.2.10]
Organism
psop  Paenibacillus sophorae
Brite
KEGG Orthology (KO) [BR:psop00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    KP014_15900
Enzymes [BR:psop01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     KP014_15900
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Hydrolase Cation_ATPase Cation_ATPase_N HAD Hydrolase_3
Other DBs
NCBI-ProteinID: QWU13480
UniProt: A0A1H8JTE6
LinkDB
Position
3368570..3371413
AA seq 947 aa
MEQKSWHRLSSEELQKTFAVSPQRGLDDEEAEARRKEKGLNELSEGEKISPLTLLLNQFK
DFMVLVLMGATLVSGLLGEYLDAITIVAIIALNGVLGFVQEFRAERSLRALKQLSAPSAK
VLRDGTVQHIPAKLLVPGDIVLLESGDRVPADLRWLKCSALYCEESALTGESLPVSKHSE
PIHAEEVPLGDQKNIGFMGTMVTRGTGKAIVVRTGMDTEMGKIAGLIQSTDTQETPLQRR
LEQLGKILIYVSLALTVVVVLAGILHGQPAVSMFLAGVSLAVAAIPEGLPAIVTIALALG
VQRMIKRKAIVRKLPSVETLGCASVICSDKTGTLTQNKMTVTRVWSGGRSLEVTGEGYAP
IGAILDKGKPADLKHDQSLRRLLQIGALCNNAEIYETASAETKTKRRDKGKGKGGEGETA
SSTAKVWALKGDPTEGALVALSAKMGLTASALGATFSRDKEFPFDSERKLMSVTVTHPGG
RMVCTKGAPDVLLSRCSYMLWEGQVVPCTPTLRQKALDANEAMASDALRVLGLAYRELRP
NEQANSEKDAESQLVFAGLAGMIDPPRREVRDAISVTRRAGIKTVMITGDHGTTAEAIAG
QLGILQRGGKVLTGSQLSRMDDDALDKLSDSVSVYARVSPEHKLRIVKSLQRHGHVVAMT
GDGVNDAPAIKAADIGIAMGITGTDVSKEASALILGDDNFSTIVAAIEEGRSIYENIRKF
IRYLLASNVGEILTMFFAMMLGLPLPLVPIQILWVNLVTDGLPAMALGVDQPEKDLMEHK
PRGAKENIFARRLGWKIISRGILIGLCTLAAFWLTLRIAPEDPVQLVRAQSVAFATLVMA
QLFHVFDCRSSRSVFHRNPFTNKYLVLAVLSSVLLMLAVMYIPVMQPIFKTIPLGFRDWS
LCLVAAGIPTFLMGAGSVWSGKRNRKRSRSGGSGGGQTMLKSTKISA
NT seq 2844 nt   +upstreamnt  +downstreamnt
atggaacaaaaaagttggcaccggctcagcagcgaggaactgcaaaagacattcgcggtt
tcgccgcagcggggccttgacgatgaggaggctgaagcaagacgcaaggagaaggggcta
aacgagctgtcggagggagaaaaaatatccccgctgacgctgctgctcaatcagttcaag
gatttcatggtcctggtgcttatgggggcgacgcttgtatcggggctgctgggcgaatat
ctggatgcgatcacgattgtcgctatcatagccctaaacggggtactcgggtttgttcag
gagtttcgcgcagagcgctcgctgcgggcgctcaagcagctgtccgcgccttcggcaaaa
gtgctgcgtgacgggaccgtgcagcacatcccggcgaagctgcttgttcccggcgacatc
gtgctgcttgaaagcggcgaccgggtccccgccgatttgcgctggcttaaatgcagcgcg
ctgtactgcgaggaatcggcattgactggggaatcgctgccggtctccaaacactcggag
ccgatacacgccgaggaagttccgcttggcgatcagaagaacatcggcttcatgggcaca
atggtaacccggggaacgggcaaagcgattgtggtccgtaccgggatggatacggaaatg
ggcaaaatcgcgggcctgatccagagcaccgacactcaggaaacacccctgcagcgccgg
ctggagcagcttggtaaaattctgatctacgtctcgctcgctctgaccgtagtagtggtg
cttgccgggattttacatggccagcctgcggtgtcgatgtttctggcaggggtcagcctt
gcggtcgctgcgatacccgaaggactgcccgcgatcgttacgatcgcgcttgctctcggt
gtgcagcggatgatcaagcgcaaggcgattgtgcgcaagctcccctcggtagagacactg
ggctgcgcgtccgttatctgttccgacaagaccggaacgctgacgcagaataagatgacg
gtaacccgcgtgtggagcggagggcgcagtcttgaagtgactggcgaaggatatgcgccg
attggggcaattctcgacaagggaaagcctgcggatttgaaacatgatcagagcctgaga
agattgctccaaattggcgcgttatgcaacaacgcggagatctacgagacggcttctgct
gaaacgaagaccaagcgtagagataaaggcaaggggaagggcggcgaaggagagacggca
tcttccacagccaaggtctgggcgctcaaaggcgacccgacagagggggcgcttgtggcg
ctgtccgcgaagatggggctgaccgcctcggcgctgggcgcaaccttctccagagacaag
gagtttccgttcgattccgaacggaagctgatgtcggtgaccgtgacccatcccggcggc
cgcatggtgtgcacgaagggcgcgcccgatgtgctgctgagccgctgttcgtatatgctg
tgggaaggccaggttgtgccctgcacgccaacgctccggcaaaaagcgctggacgcgaac
gaagcgatggcttcggacgccctccgcgtgctcggtctggcttaccgggagctgcggcct
aatgagcaagctaattcagagaaggatgccgaaagccagctggtcttcgccgggctcgcc
ggtatgatcgatccgccgcgccgggaggtgcgggatgcgatcagcgtcacccggcgggcg
ggcatcaagacggtgatgatcaccggcgatcacggcaccacagccgaggcgattgcgggt
cagctcggcatcctccagcgcggcggcaaggtgctgacaggcagccagctgtcgcggatg
gacgatgatgcgctcgacaaattgtcggacagtgtgagcgtctatgcccgcgtttcgccc
gagcacaagctgcgcatcgtgaagtcgctgcagcgtcacggccatgttgtggccatgacg
ggcgacggagtcaacgatgccccggccatcaaggcggcggacattggcatagctatgggc
attacaggaacggatgtaagcaaggaagcttccgcgctcattttaggagacgataatttc
tcgacaattgtggcagcaattgaggaaggccggagcatttatgagaatatccgcaaattc
atccggtatttgctcgcttcgaatgtcggcgagattctgaccatgttctttgcaatgatg
ctcggtctgccgctgccgcttgtgccgatccagatattatgggtcaatctcgtcacggac
ggtctgcccgccatggcgctgggcgtagaccagcccgagaaggacttgatggaacacaag
ccgcgcggcgccaaagaaaatatcttcgcccgccggctcggctggaagattatcagccgc
ggcattctgatagggctgtgcacgctagccgccttctggctgacgcttcgtattgccccg
gaagatccggtccaactggtgagagcacagtcggtagcgttcgccactctcgttatggcc
cagctgttccatgtattcgactgccggagctcgcgctccgtgttccaccgaaacccgttc
acgaataaatatcttgtgcttgcggtgctctcgtccgtgctgctgatgctggcggttatg
tacattccggtgatgcagccgatcttcaagacgataccgcttggcttccgggactggtcg
ctgtgtttggtagcagctgggattcccaccttcctaatgggcgcaggcagtgtctggagc
gggaagcggaaccggaagcgcagccgcagcggcggcagcggcggcggacagaccatgctg
aaaagtacaaaaatttcggcataa

DBGET integrated database retrieval system