Paenibacillus sophorae: KP014_17150 Help Entry KP014_17150       CDS       T07500                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism psop  Paenibacillus sophorae Pathway psop00998   Biosynthesis of various antibiotics psop01100   Metabolic pathways psop01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psop00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KP014_17150    00074 Mycolic acid biosynthesis     KP014_17150   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KP014_17150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QWU13709 LinkDB All DBs Position 3631551..3631826 Genome browser AA seq 91 aa AA seqDB search MSKQGVTEQIIQLIKQKISSSPGSSSEDASITADTLLRDVWLRLESIQVVELVVELETEY ETELPDELLGQIDRSSLNVADLAAMVTGNAV NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagtaagcaaggtgttaccgagcaaattattcaactgatcaagcaaaaaatatcgtct tccccaggctcatcctctgaggacgcgtccattacggctgacacgctgctgcgcgatgtg tggcttagactggagtcgattcaggtcgttgaacttgtcgtagagttggagacggaatac gagacggagctgccggatgaactcctgggccagatagacagaagctcattaaatgtagcc gatctggccgcaatggttacaggtaatgcagtctag

DBGET integrated database retrieval system