Pseudomonas sp. Os17: POS17_0469 Help Entry POS17_0469        CDS       T04177                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism psos  Pseudomonas sp. Os17 Pathway psos00998   Biosynthesis of various antibiotics psos01100   Metabolic pathways psos01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:psos00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     POS17_0469    00074 Mycolic acid biosynthesis     POS17_0469   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     POS17_0469 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BAQ72163 LinkDB All DBs Position complement(513364..513636) Genome browser AA seq 90 aa AA seqDB search MSDTHPDLMLEIKLLIIDALGLEDISAQDIGNDQTLFGEGLGLDSVDALELGLAIQKKYG IKIDADAKDTRNHFSNVASLAAFVTAKQAA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagcgatacacacccggacctgatgcttgaaatcaaactgctgatcatcgacgccctg ggcctcgaagacatcagcgcccaggacatcggcaacgatcagacgctgttcggcgaaggc ctcggcctggactcggtggacgccctggaactgggcctggcgatccagaaaaagtacggc atcaagatcgatgccgacgccaaggacacccgcaaccacttcagtaacgtggcgagcctt gcggcgttcgtcactgcaaaacaggcagcttga

DBGET integrated database retrieval system